PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51747.2.p
Common NameBRADI_1g51747, LOC100833140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 262aa    MW: 28333.2 Da    PI: 7.5847
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51747.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+llvd++ + G g+W++ ++  g++R++k+c++rw +yl
  Bradi1g51747.2.p 15 KGPWTPEEDKLLVDYISEKGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                      79********************************************97 PP

2Myb_DNA-binding537.6e-1768113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr+  +E++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Bradi1g51747.2.p  68 RGRFDDDEEKLIIHLHSILGNK-WSSIATKLP-GRTDNEIKNYWNTHL 113
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3261062IPR017930Myb domain
SuperFamilySSF466891.65E-2912109IPR009057Homeodomain-like
SMARTSM007171.9E-141464IPR001005SANT/Myb domain
PfamPF002491.2E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-231669IPR009057Homeodomain-like
CDDcd001675.08E-111762No hitNo description
PROSITE profilePS5129426.3563117IPR017930Myb domain
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PfamPF002495.1E-1568113IPR001005SANT/Myb domain
CDDcd001672.67E-1170113No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2570117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRSPCCDGE AGVKKGPWTP EEDKLLVDYI SEKGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGR FDDDEEKLII HLHSILGNKW SSIATKLPGR TDNEIKNYWN THLRKKLLGM  120
GIDPVTHRPR TDLSLLAGLP ALLAAAGSFS SGSGAGASWV ENMNALRLQA DAAKFQLLQG  180
LVRALTTNTS AAAAPMAGNG GGSGVQDHLM ALLGGGEETT PASSPMFFDG LESLNLDDHL  240
NTDGGWKDLL EQMSWLNSTE L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-122KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229990.11e-131PREDICTED: WAG22 antigen
SwissprotQ8GWP03e-77MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0Q3JQH01e-131A0A0Q3JQH0_BRADI; Uncharacterized protein
STRINGBRADI1G51747.11e-130(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-78myb domain protein 9